PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00018.1.g02650.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 357aa    MW: 37998.4 Da    PI: 9.3108
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00018.1.g02650.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1208.8e-383995561
                        zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                                    +cprC+s++tkfCyynny++sqPr+fCk+CrryWtkGG+lrnvPvGgg+rk+ ++
  Zjn_sc00018.1.g02650.1.am.mk 39 GEPCPRCESRETKFCYYNNYNTSQPRHFCKSCRRYWTKGGSLRNVPVGGGTRKSSSA 95
                                  578**************************************************9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-233989IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.6774094IPR003851Zinc finger, Dof-type
PfamPF027016.4E-324093IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104278IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MQEPTRRPAP PFAGVDLRRP KGYPEPATVK VEEAPATAGE PCPRCESRET KFCYYNNYNT  60
SQPRHFCKSC RRYWTKGGSL RNVPVGGGTR KSSSASPASP KNPKRSKNSK RRRVAPSPDP  120
APSTDDAVAS NAGVGDREPT PAPLTEDAAA GNVEDRAHVA PPAAEQGFKS TSVARGLGVT  180
DAGGGGGKEP PDTGPFEWPS SCGDLGSFWG AGVFTDTDPA LPVEFDPSGL SRRGHAPPMT  240
QPGALLRDRV RQLIGNFRLP RTYDGRAGVA WGSTARWSVP PSPGAFGWTS TSWCFELRAA  300
ADADGSLIPT ATRALYAASG SVVGWISIVT SSREWRGEGV HTRCWLPTGV FLPQLCH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1109113KRRRV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957110.12e-76PREDICTED: dof zinc finger protein MNB1A-like
TrEMBLK3ZVZ32e-76K3ZVZ3_SETIT; Uncharacterized protein
STRINGSi030774m5e-76(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.13e-27DOF zinc finger protein 1